PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10428500g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family TALE
Protein Properties Length: 438aa    MW: 48675 Da    PI: 6.9379
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10428500g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.59.5e-083874202154
                       HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       k +yp+++e+++L +++gL+ +q+ +WF N+R +
  MA_10428500g0010 387 KWPYPTEDEKTRLVQETGLQLKQINNWFINQRKR 420
                       469*****************************87 PP

2ELK30.58.4e-11341362122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       ELKh+L+++Y++++ ++++E++
  MA_10428500g0010 341 ELKHELKQGYRSRIEDIREEIL 362
                       9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.2E-17172216IPR005540KNOX1
PfamPF037903.5E-15174215IPR005540KNOX1
SMARTSM012561.1E-21227283IPR005541KNOX2
PfamPF037919.6E-16234282IPR005541KNOX2
PfamPF037898.0E-5341362IPR005539ELK domain
SMARTSM011880.0016341362IPR005539ELK domain
PROSITE profilePS5121310.301341361IPR005539ELK domain
PROSITE profilePS5007111.742361424IPR001356Homeobox domain
SuperFamilySSF466892.69E-16363428IPR009057Homeodomain-like
SMARTSM003894.7E-11363428IPR001356Homeobox domain
CDDcd000862.90E-11364423No hitNo description
Gene3DG3DSA:1.10.10.608.8E-25368425IPR009057Homeodomain-like
PfamPF059201.7E-17381420IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MVPRPGVDVV DVHLTRVILL AGRQSRGTWR AHPSRWTAVT RDLAGPPDMN EGSGLKVGAT  60
ATWLNSLSHH HHHHHPNSHV EGDQPGMMGF SAQQQHSHGS TIIDHSASAA AAAAGGGGGG  120
GGGQGRGMLD LHSDTANSSE LLGSSRSDGD HPHHHHDQQQ QQQENHMVWQ NSRLKADVLQ  180
HPLYDQLLAA HVACLRIATP VDQLPKIDAQ LAQQHHVVAK YSVLGRNQLL TGEEKEELDR  240
FLAQYVLLLS SFKEQLQQHV RVHAMEAVMA CWELEQSLHT LTGVSPGEGT GATMSDDEDD  300
QADSDTNLFD LGLDGQDGVG SFGPLIPTEN ERSLMERVRQ ELKHELKQGY RSRIEDIREE  360
ILRKRRAGKL PGDTTSVLKN WWQAHSKWPY PTEDEKTRLV QETGLQLKQI NNWFINQRKR  420
NWHSNPSSSS ASNAKRKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-13364428872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1417437RKRNWHSNPSSSSASNAKRKR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1101820.0BT110182.1 Picea glauca clone GQ03217_K05 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136984.11e-158hypothetical protein PHAVU_009G090500g
RefseqXP_007136985.11e-158hypothetical protein PHAVU_009G090500g
SwissprotP480001e-153KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLA0A0C9RWA60.0A0A0C9RWA6_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_9387_2069 transcribed RNA sequence
TrEMBLA0A0C9S9540.0A0A0C9S954_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_9388_2056 transcribed RNA sequence
STRINGGLYMA04G06810.11e-156(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16717148
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.21e-142KNOTTED1-like homeobox gene 3